Lineage for d1tgha1 (1tgh A:155-252)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.129: TBP-like [55944] (3 superfamilies) 
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) 
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species) 
Species Human (Homo sapiens) [TaxId:9606] [55948] (3 PDB entries) 
Domain d1tgha1: 1tgh A:155-252 [41214]
Details for d1tgha1
PDB Entry: 1tgh (more details), 2.9 Å
PDB Description: tata binding protein (tbp)/dna complex
SCOP Domain Sequences for d1tgha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tgha1 d.129.1.1 (A:155-252) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)}
sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk
mvctgakseeqsrlaarkyarvvqklgfpakfldfkiq
SCOP Domain Coordinates for d1tgha1:
Click to download the PDB-style file with coordinates for d1tgha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tgha1:
- d1tgha1 appears in SCOP 1.57
- d1tgha1 appears in the current release, SCOPe 2.08
View in 3D
