Lineage for d1tgha1 (1tgh A:155-252)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975209Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2975210Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 2975211Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 2975237Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries)
  8. 2975254Domain d1tgha1: 1tgh A:155-252 [41214]
    protein/DNA complex

Details for d1tgha1

PDB Entry: 1tgh (more details), 2.9 Å

PDB Description: tata binding protein (tbp)/dna complex
PDB Compounds: (A:) protein (tata binding protein (tbp))

SCOPe Domain Sequences for d1tgha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgha1 d.129.1.1 (A:155-252) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk
mvctgakseeqsrlaarkyarvvqklgfpakfldfkiq

SCOPe Domain Coordinates for d1tgha1:

Click to download the PDB-style file with coordinates for d1tgha1.
(The format of our PDB-style files is described here.)

Timeline for d1tgha1: