Lineage for d1cdwa2 (1cdw A:253-333)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926122Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1926123Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 1926124Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 1926150Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries)
  8. 1926152Domain d1cdwa2: 1cdw A:253-333 [41213]
    protein/DNA complex

Details for d1cdwa2

PDB Entry: 1cdw (more details), 1.9 Å

PDB Description: human tbp core domain complexed with dna
PDB Compounds: (A:) protein (tata binding protein (tbp))

SCOPe Domain Sequences for d1cdwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdwa2 d.129.1.1 (A:253-333) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikprivllifvsgkvvltgak
vraeiyeafeniypilkgfrk

SCOPe Domain Coordinates for d1cdwa2:

Click to download the PDB-style file with coordinates for d1cdwa2.
(The format of our PDB-style files is described here.)

Timeline for d1cdwa2: