Lineage for d1cdwa2 (1cdw A:253-333)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35720Fold d.129: TBP-like [55944] (3 superfamilies)
  4. 35721Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 35722Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
  6. 35723Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
  7. 35788Species Human (Homo sapiens) [TaxId:9606] [55948] (3 PDB entries)
  8. 35790Domain d1cdwa2: 1cdw A:253-333 [41213]

Details for d1cdwa2

PDB Entry: 1cdw (more details), 1.9 Å

PDB Description: human tbp core domain complexed with dna

SCOP Domain Sequences for d1cdwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdwa2 d.129.1.1 (A:253-333) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)}
nmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikprivllifvsgkvvltgak
vraeiyeafeniypilkgfrk

SCOP Domain Coordinates for d1cdwa2:

Click to download the PDB-style file with coordinates for d1cdwa2.
(The format of our PDB-style files is described here.)

Timeline for d1cdwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdwa1