SCOPe 2.08: Domain d1cdwa1: 1cdw A:155-252

Lineage for d1cdwa1 (1cdw A:155-252)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats
   automatically mapped to Pfam PF00352

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries)

8. Domain d1cdwa1: 1cdw A:155-252 [41212]
   protein/DNA complex

Details for d1cdwa1

PDB Entry: 1cdw, 1.9 Å

PDB Description: human tbp core domain complexed with dna

PDB Compounds: (A:) protein (tata binding protein (tbp))

SCOPe Domain Sequences for d1cdwa1:

Sequence; same for both SEQRES and ATOM records:

>d1cdwa1 d.129.1.1 (A:155-252) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk
mvctgakseensrlaarkyarvvqklgfpakfldfkiq

Timeline for d1cdwa1:

• d1cdwa1 first appeared (with stable ids) in SCOP 1.55
  
• d1cdwa1 appears in SCOPe 2.07