Lineage for d1bg0_2 (1bg0 96-357)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261944Fold d.128: Glutamine synthase/guanido kinase [55930] (1 superfamily)
  4. 261945Superfamily d.128.1: Glutamine synthase/guanido kinase [55931] (2 families) (S)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  5. 262048Family d.128.1.2: Guanido kinase catalytic domain [55935] (2 proteins)
  6. 262049Protein Arginine kinase, C-terminal domain [55942] (1 species)
  7. 262050Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (3 PDB entries)
  8. 262052Domain d1bg0_2: 1bg0 96-357 [41211]
    Other proteins in same PDB: d1bg0_1
    complexed with adp, mg, no3

Details for d1bg0_2

PDB Entry: 1bg0 (more details), 1.86 Å

PDB Description: transition state structure of arginine kinase

SCOP Domain Sequences for d1bg0_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg0_2 d.128.1.2 (96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte
yqavremqdgilemikmekaaa

SCOP Domain Coordinates for d1bg0_2:

Click to download the PDB-style file with coordinates for d1bg0_2.
(The format of our PDB-style files is described here.)

Timeline for d1bg0_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bg0_1