Lineage for d1g0wa2 (1g0w A:103-381)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581287Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2581288Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2581421Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2581449Protein Creatine kinase, C-terminal domain [55936] (7 species)
  7. 2581460Species Cow (Bos taurus), retinal isoform [TaxId:9913] [55941] (1 PDB entry)
  8. 2581461Domain d1g0wa2: 1g0w A:103-381 [41210]
    Other proteins in same PDB: d1g0wa1
    complexed with so4

Details for d1g0wa2

PDB Entry: 1g0w (more details), 2.3 Å

PDB Description: crystal structure of bovine retinal creatine kinase
PDB Compounds: (A:) creatine kinase

SCOPe Domain Sequences for d1g0wa2:

Sequence, based on SEQRES records: (download)

>d1g0wa2 d.128.1.2 (A:103-381) Creatine kinase, C-terminal domain {Cow (Bos taurus), retinal isoform [TaxId: 9913]}
tdehktdlnpdnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklaveal
ssldgdlagryyalksmteaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwineedhlrvismqkggnmkevftrfcngltqietlfksknyefmwnphlgyilt
cpsnlgtglragvhiklphlgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrl
gfsevelvqmvvdgvklliemeqrleqgqaiddlmpaqk

Sequence, based on observed residues (ATOM records): (download)

>d1g0wa2 d.128.1.2 (A:103-381) Creatine kinase, C-terminal domain {Cow (Bos taurus), retinal isoform [TaxId: 9913]}
tdehktdlnpdnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklaveal
ssldgdlagryyalksmteaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwineedhlrvismqkggnmkevftrfcngltqietlfksknyefmwnphlgyilt
cpsnlgtglragvhiklphlgkhekfsevlkrlrlqkrgvggvfdvsnadrlgfsevelv
qmvvdgvklliemeqrleqgqaiddlmpaqk

SCOPe Domain Coordinates for d1g0wa2:

Click to download the PDB-style file with coordinates for d1g0wa2.
(The format of our PDB-style files is described here.)

Timeline for d1g0wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g0wa1