Lineage for d1g0wa2 (1g0w A:103-381)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35661Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily)
  4. 35662Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) (S)
  5. 35692Family d.128.1.2: Guanido kinases [55935] (2 proteins)
  6. 35696Protein Creatine kinase, C-terminal domain [55936] (5 species)
  7. 35707Species Cow (Bos taurus), retinal isoform [TaxId:9913] [55941] (1 PDB entry)
  8. 35708Domain d1g0wa2: 1g0w A:103-381 [41210]
    Other proteins in same PDB: d1g0wa1

Details for d1g0wa2

PDB Entry: 1g0w (more details), 2.3 Å

PDB Description: crystal structure of bovine retinal creatine kinase

SCOP Domain Sequences for d1g0wa2:

Sequence, based on SEQRES records: (download)

>d1g0wa2 d.128.1.2 (A:103-381) Creatine kinase, C-terminal domain {Cow (Bos taurus), retinal isoform}
tdehktdlnpdnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklaveal
ssldgdlagryyalksmteaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwineedhlrvismqkggnmkevftrfcngltqietlfksknyefmwnphlgyilt
cpsnlgtglragvhiklphlgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrl
gfsevelvqmvvdgvklliemeqrleqgqaiddlmpaqk

Sequence, based on observed residues (ATOM records): (download)

>d1g0wa2 d.128.1.2 (A:103-381) Creatine kinase, C-terminal domain {Cow (Bos taurus), retinal isoform}
tdehktdlnpdnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklaveal
ssldgdlagryyalksmteaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwineedhlrvismqkggnmkevftrfcngltqietlfksknyefmwnphlgyilt
cpsnlgtglragvhiklphlgkhekfsevlkrlrlqkrgvggvfdvsnadrlgfsevelv
qmvvdgvklliemeqrleqgqaiddlmpaqk

SCOP Domain Coordinates for d1g0wa2:

Click to download the PDB-style file with coordinates for d1g0wa2.
(The format of our PDB-style files is described here.)

Timeline for d1g0wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g0wa1