Lineage for d1qk1e2 (1qk1 E:103-379)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2974891Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2974919Protein Creatine kinase, C-terminal domain [55936] (7 species)
  7. 2974932Species Human (Homo sapiens), mitochondria [TaxId:9606] [55939] (1 PDB entry)
  8. 2974937Domain d1qk1e2: 1qk1 E:103-379 [41205]
    Other proteins in same PDB: d1qk1a1, d1qk1b1, d1qk1c1, d1qk1d1, d1qk1e1, d1qk1f1, d1qk1g1, d1qk1h1
    complexed with po4

Details for d1qk1e2

PDB Entry: 1qk1 (more details), 2.7 Å

PDB Description: crystal structure of human ubiquitous mitochondrial creatine kinase
PDB Compounds: (E:) creatine kinase, ubiquitous mitochondrial

SCOPe Domain Sequences for d1qk1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qk1e2 d.128.1.2 (E:103-379) Creatine kinase, C-terminal domain {Human (Homo sapiens), mitochondria [TaxId: 9606]}
ttdldaskirsgyfderyvlssrvrtgrsirglslppactraerrevervvvdalsglkg
dlagryyrlsemteaeqqqliddhflfdkpvsplltaagmardwpdargiwhnneksfli
wvneedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltcpsnl
gtglragvhiklpllskdsrfpkilenlrlqkrgtggvdtaatggvfdisnldrlgksev
elvqlvidgvnylidcerrlergqdiriptpvihtkh

SCOPe Domain Coordinates for d1qk1e2:

Click to download the PDB-style file with coordinates for d1qk1e2.
(The format of our PDB-style files is described here.)

Timeline for d1qk1e2: