SCOPe 2.08: Domain d6v4oh_: 6v4o H:

Lineage for d6v4oh_ (6v4o H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6v4oh_: 6v4o H: [411991]
   Other proteins in same PDB: d6v4ob1, d6v4ob2, d6v4oe1, d6v4oe2, d6v4og1, d6v4og2, d6v4oi1, d6v4oi2, d6v4ol1, d6v4ol2, d6v4om1, d6v4om2, d6v4on1, d6v4on2, d6v4ow1, d6v4ow2
   automated match to d6shgh_
   complexed with bma, ca

Details for d6v4oh_

PDB Entry: 6v4o, 2.8 Å

PDB Description: structure of human 2e01 fab in complex with influenza virus neuraminidase from b/phuket/3073/2013

PDB Compounds: (H:) antibody fab heavy chain

SCOPe Domain Sequences for d6v4oh_:

Sequence, based on SEQRES records:

>d6v4oh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgssvkvsckasgytfinhalswvrqapgqglewvggiipifglaky
gqkfqdrvtitadestktaymdlrslrsddtavyycardtvavyedfdwsspyffymdvw
gkgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgv
htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d6v4oh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgssvkvsckasgytfinhalswvrqapgqglewvggiipifglaky
gqkfqdrvtitadestktaymdlrslrsddtavyycardtvavyedfdwsspyffymdvw
gkgttvtvssastkgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d6v4oh_:

• d6v4oh_ is new in SCOPe 2.08-stable