Lineage for d1qh4c2 (1qh4 C:103-381)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733061Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 733062Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 733193Family d.128.1.2: Guanido kinase catalytic domain [55935] (2 proteins)
  6. 733204Protein Creatine kinase, C-terminal domain [55936] (7 species)
  7. 733205Species Chicken (Gallus gallus), brain-type [TaxId:9031] [55938] (1 PDB entry)
  8. 733208Domain d1qh4c2: 1qh4 C:103-381 [41199]
    Other proteins in same PDB: d1qh4a1, d1qh4b1, d1qh4c1, d1qh4d1

Details for d1qh4c2

PDB Entry: 1qh4 (more details), 1.41 Å

PDB Description: crystal structure of chicken brain-type creatine kinase at 1.41 angstrom resolution
PDB Compounds: (C:) creatine kinase

SCOP Domain Sequences for d1qh4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh4c2 d.128.1.2 (C:103-381) Creatine kinase, C-terminal domain {Chicken (Gallus gallus), brain-type [TaxId: 9031]}
tdehktdlnadnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklsveal
gslggdlkgkyyalrnmtdaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwineedhlrvismqkggnmkevftrfctgltqietlfksknyefmwnphlgyilt
cpsnlgtglragvhiklpnlgkhekfgevlkrlrlqkrgtggvdtaavggvfdvsnadrl
gfsevelvqmvvdgvklliemekrlekgqsiddlmpaqk

SCOP Domain Coordinates for d1qh4c2:

Click to download the PDB-style file with coordinates for d1qh4c2.
(The format of our PDB-style files is described here.)

Timeline for d1qh4c2: