Lineage for d1qh4c2 (1qh4 C:103-381)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily) Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) 
Family d.128.1.2: Guanido kinases [55935] (2 proteins) Protein Creatine kinase, C-terminal domain [55936] (5 species) Species Chicken (Gallus gallus), brain-type [TaxId:9031] [55938] (1 PDB entry) 
Domain d1qh4c2: 1qh4 C:103-381 [41199]
Other proteins in same PDB: d1qh4a1, d1qh4b1, d1qh4c1, d1qh4d1
Details for d1qh4c2
PDB Entry: 1qh4 (more details), 1.41 Å
PDB Description: crystal structure of chicken brain-type creatine kinase at 1.41 angstrom resolution
SCOP Domain Sequences for d1qh4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qh4c2 d.128.1.2 (C:103-381) Creatine kinase, C-terminal domain {Chicken (Gallus gallus), brain-type}
tdehktdlnadnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklsveal
gslggdlkgkyyalrnmtdaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwineedhlrvismqkggnmkevftrfctgltqietlfksknyefmwnphlgyilt
cpsnlgtglragvhiklpnlgkhekfgevlkrlrlqkrgtggvdtaavggvfdvsnadrl
gfsevelvqmvvdgvklliemekrlekgqsiddlmpaqk
SCOP Domain Coordinates for d1qh4c2:
Click to download the PDB-style file with coordinates for d1qh4c2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qh4c2:
View in 3D
