Lineage for d1qh4a2 (1qh4 A:103-381)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35661Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily)
  4. 35662Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) (S)
  5. 35692Family d.128.1.2: Guanido kinases [55935] (2 proteins)
  6. 35696Protein Creatine kinase, C-terminal domain [55936] (5 species)
  7. 35697Species Chicken (Gallus gallus), brain-type [TaxId:9031] [55938] (1 PDB entry)
  8. 35698Domain d1qh4a2: 1qh4 A:103-381 [41197]
    Other proteins in same PDB: d1qh4a1, d1qh4b1, d1qh4c1, d1qh4d1

Details for d1qh4a2

PDB Entry: 1qh4 (more details), 1.41 Å

PDB Description: crystal structure of chicken brain-type creatine kinase at 1.41 angstrom resolution

SCOP Domain Sequences for d1qh4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh4a2 d.128.1.2 (A:103-381) Creatine kinase, C-terminal domain {Chicken (Gallus gallus), brain-type}
tdehktdlnadnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklsveal
gslggdlkgkyyalrnmtdaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwineedhlrvismqkggnmkevftrfctgltqietlfksknyefmwnphlgyilt
cpsnlgtglragvhiklpnlgkhekfgevlkrlrlqkrgtggvdtaavggvfdvsnadrl
gfsevelvqmvvdgvklliemekrlekgqsiddlmpaqk

SCOP Domain Coordinates for d1qh4a2:

Click to download the PDB-style file with coordinates for d1qh4a2.
(The format of our PDB-style files is described here.)

Timeline for d1qh4a2: