Lineage for d2glsh2 (2gls H:101-468)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35661Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily)
  4. 35662Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) (S)
  5. 35663Family d.128.1.1: Glutamine synthetase, C-terminal domain [55932] (1 protein)
  6. 35664Protein Glutamine synthetase, C-terminal domain [55933] (1 species)
  7. 35665Species Salmonella typhimurium [TaxId:90371] [55934] (4 PDB entries)
  8. 35687Domain d2glsh2: 2gls H:101-468 [41188]
    Other proteins in same PDB: d2glsa1, d2glsb1, d2glsc1, d2glsd1, d2glse1, d2glsf1, d2glsg1, d2glsh1, d2glsi1, d2glsj1, d2glsk1, d2glsl1

Details for d2glsh2

PDB Entry: 2gls (more details), 3.5 Å

PDB Description: refined atomic model of glutamine synthetase at 3.5 angstroms resolution

SCOP Domain Sequences for d2glsh2:

Sequence, based on SEQRES records: (download)

>d2glsh2 d.128.1.1 (H:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrpeeddrvrmtphpv
efelyysv

Sequence, based on observed residues (ATOM records): (download)

>d2glsh2 d.128.1.1 (H:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

SCOP Domain Coordinates for d2glsh2:

Click to download the PDB-style file with coordinates for d2glsh2.
(The format of our PDB-style files is described here.)

Timeline for d2glsh2: