Lineage for d2glse2 (2gls E:101-468)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1430621Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1430622Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein)
  6. Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 1430674Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)
  8. 1430739Domain d2glse2: 2gls E:101-468 [41185]
    Other proteins in same PDB: d2glsa1, d2glsb1, d2glsc1, d2glsd1, d2glse1, d2glsf1, d2glsg1, d2glsh1, d2glsi1, d2glsj1, d2glsk1, d2glsl1
    complexed with mn

Details for d2glse2

PDB Entry: 2gls (more details), 3.5 Å

PDB Description: refined atomic model of glutamine synthetase at 3.5 angstroms resolution
PDB Compounds: (E:) glutamine synthetase

SCOPe Domain Sequences for d2glse2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glse2 d.128.1.1 (E:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

SCOPe Domain Coordinates for d2glse2:

Click to download the PDB-style file with coordinates for d2glse2.
(The format of our PDB-style files is described here.)

Timeline for d2glse2: