Lineage for d1f52e2 (1f52 E:101-468)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35661Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily)
  4. 35662Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) (S)
  5. 35663Family d.128.1.1: Glutamine synthetase, C-terminal domain [55932] (1 protein)
  6. 35664Protein Glutamine synthetase, C-terminal domain [55933] (1 species)
  7. 35665Species Salmonella typhimurium [TaxId:90371] [55934] (4 PDB entries)
  8. Domain d1f52e2: 1f52 E:101-468 [41173]
    Other proteins in same PDB: d1f52a1, d1f52b1, d1f52c1, d1f52d1, d1f52e1, d1f52f1, d1f52g1, d1f52h1, d1f52i1, d1f52j1, d1f52k1, d1f52l1

Details for d1f52e2

PDB Entry: 1f52 (more details), 2.49 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium co-crystallized with adp

SCOP Domain Sequences for d1f52e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f52e2 d.128.1.1 (E:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

SCOP Domain Coordinates for d1f52e2 are not available.

Timeline for d1f52e2:

Domains from same chain:
(mouse over for more information)
d1f52e1