Lineage for d1f52a2 (1f52 A:101-468)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2974759Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (2 proteins)
  6. 2974760Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 2974810Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)
  8. 2974811Domain d1f52a2: 1f52 A:101-468 [41169]
    Other proteins in same PDB: d1f52a1, d1f52b1, d1f52c1, d1f52d1, d1f52e1, d1f52f1, d1f52g1, d1f52h1, d1f52i1, d1f52j1, d1f52k1, d1f52l1
    complexed with adp, mn, mpd

Details for d1f52a2

PDB Entry: 1f52 (more details), 2.49 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium co-crystallized with adp
PDB Compounds: (A:) glutamine synthetase

SCOPe Domain Sequences for d1f52a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f52a2 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

SCOPe Domain Coordinates for d1f52a2:

Click to download the PDB-style file with coordinates for d1f52a2.
(The format of our PDB-style files is described here.)

Timeline for d1f52a2: