Lineage for d1lgr_2 (1lgr 101-468)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35661Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily)
  4. 35662Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) (S)
  5. 35663Family d.128.1.1: Glutamine synthetase, C-terminal domain [55932] (1 protein)
  6. 35664Protein Glutamine synthetase, C-terminal domain [55933] (1 species)
  7. 35665Species Salmonella typhimurium [TaxId:90371] [55934] (4 PDB entries)
  8. 35666Domain d1lgr_2: 1lgr 101-468 [41167]
    Other proteins in same PDB: d1lgr_1

Details for d1lgr_2

PDB Entry: 1lgr (more details), 2.8 Å

PDB Description: interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium

SCOP Domain Sequences for d1lgr_2:

Sequence, based on SEQRES records: (download)

>d1lgr_2 d.128.1.1 (101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

Sequence, based on observed residues (ATOM records): (download)

>d1lgr_2 d.128.1.1 (101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvppvmlaysarnrsasir
ipvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdipqvagsleea
lnaldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv

SCOP Domain Coordinates for d1lgr_2:

Click to download the PDB-style file with coordinates for d1lgr_2.
(The format of our PDB-style files is described here.)

Timeline for d1lgr_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lgr_1