Lineage for d6ppgh_ (6ppg H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (23 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (689 PDB entries)
  8. 2742981Domain d6ppgh_: 6ppg H: [411669]
    Other proteins in same PDB: d6ppga1, d6ppga2, d6ppgf_, d6ppgg_, d6ppgl1, d6ppgl2
    automated match to d6shgh_
    complexed with cd, nag

Details for d6ppgh_

PDB Entry: 6ppg (more details), 2.75 Å

PDB Description: crystal structure of il17ff bound to fab fragments of mcaf5352a
PDB Compounds: (H:) Fab MCAF5352A heavy chain

SCOPe Domain Sequences for d6ppgh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ppgh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpgrslrlscaasgftfddyamhwvrqapgkglewvsginwssggigy
adsvkgrftisrdnaknslylqmnslraedtalyycardiggfgefywnfglwgrgtlvt
vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc

SCOPe Domain Coordinates for d6ppgh_:

Click to download the PDB-style file with coordinates for d6ppgh_.
(The format of our PDB-style files is described here.)

Timeline for d6ppgh_:

  • d6ppgh_ is new in SCOPe 2.08-stable