![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) |
![]() | Protein Aminopeptidase P, C-terminal domain [55928] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55929] (5 PDB entries) |
![]() | Domain d1a16_2: 1a16 177-440 [41165] Other proteins in same PDB: d1a16_1 complexed with mn |
PDB Entry: 1a16 (more details), 2.3 Å
SCOP Domain Sequences for d1a16_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a16_2 d.127.1.1 (177-440) Aminopeptidase P, C-terminal domain {Escherichia coli} speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn enltasvvkkpeeiealmvaarkq
Timeline for d1a16_2: