Lineage for d1a16_2 (1a16 177-440)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418013Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 418014Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 418015Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 418016Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 418020Species Escherichia coli [TaxId:562] [55929] (5 PDB entries)
  8. 418023Domain d1a16_2: 1a16 177-440 [41165]
    Other proteins in same PDB: d1a16_1
    complexed with mn

Details for d1a16_2

PDB Entry: 1a16 (more details), 2.3 Å

PDB Description: aminopeptidase p from e. coli with the inhibitor pro-leu

SCOP Domain Sequences for d1a16_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a16_2 d.127.1.1 (177-440) Aminopeptidase P, C-terminal domain {Escherichia coli}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOP Domain Coordinates for d1a16_2:

Click to download the PDB-style file with coordinates for d1a16_2.
(The format of our PDB-style files is described here.)

Timeline for d1a16_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a16_1