Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) |
Protein Aminopeptidase P, C-terminal domain [55928] (1 species) |
Species Escherichia coli [TaxId:562] [55929] (4 PDB entries) |
Domain d1az9_2: 1az9 177-440 [41164] Other proteins in same PDB: d1az9_1 complexed with mn |
PDB Entry: 1az9 (more details), 2 Å
SCOP Domain Sequences for d1az9_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1az9_2 d.127.1.1 (177-440) Aminopeptidase P, C-terminal domain {Escherichia coli} speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn enltasvvkkpeeiealmvaarkq
Timeline for d1az9_2: