SCOP 1.65: Domain d1az9_2: 1az9 177-440

Lineage for d1az9_2 (1az9 177-440)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Aminopeptidase P, C-terminal domain [55928] (1 species)

7. Species Escherichia coli [TaxId:562] [55929] (4 PDB entries)

8. Domain d1az9_2: 1az9 177-440 [41164]
   Other proteins in same PDB: d1az9_1
   complexed with mn

Details for d1az9_2

PDB Entry: 1az9, 2 Å

PDB Description: aminopeptidase p from e. coli

SCOP Domain Sequences for d1az9_2:

Sequence; same for both SEQRES and ATOM records:

>d1az9_2 d.127.1.1 (177-440) Aminopeptidase P, C-terminal domain {Escherichia coli}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

Timeline for d1az9_2:

• d1az9_2 first appeared (with stable ids) in SCOP 1.55
  
• d1az9_2 appears in SCOP 1.63
  
• d1az9_2 appears in SCOP 1.67
  
• d1az9_2 last appears in SCOP 1.71