Lineage for d1b59a2 (1b59 A:110-374,A:449-478)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35625Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
  4. 35626Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 35627Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 35637Protein Methionine aminopeptidase [55924] (3 species)
  7. 35648Species Human (Homo sapiens) [TaxId:9606] [55927] (4 PDB entries)
  8. 35651Domain d1b59a2: 1b59 A:110-374,A:449-478 [41162]
    Other proteins in same PDB: d1b59a1

Details for d1b59a2

PDB Entry: 1b59 (more details), 1.8 Å

PDB Description: complex of human methionine aminopeptidase-2 complexed with ovalicin

SCOP Domain Sequences for d1b59a2:

Sequence, based on SEQRES records: (download)

>d1b59a2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens)}
kvqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndf
reaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnnca
ahytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgik
cagidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpivkg
geatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

Sequence, based on observed residues (ATOM records): (download)

>d1b59a2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens)}
kvqtdppsvpicdlypngvfpkgqeceypeekkaldqaseeiwndfreaaeahrqvrkyv
mswikpgmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdttvlq
yddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdvgea
iqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpivkggeatrmeegevyai
etfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

SCOP Domain Coordinates for d1b59a2:

Click to download the PDB-style file with coordinates for d1b59a2.
(The format of our PDB-style files is described here.)

Timeline for d1b59a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b59a1