Lineage for d1b6a_2 (1b6a 110-374,449-478)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333987Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 333988Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 333989Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 334008Protein Methionine aminopeptidase [55924] (4 species)
  7. 334027Species Human (Homo sapiens) [TaxId:9606] [55927] (4 PDB entries)
    methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold
  8. 334028Domain d1b6a_2: 1b6a 110-374,449-478 [41160]
    Other proteins in same PDB: d1b6a_1

Details for d1b6a_2

PDB Entry: 1b6a (more details), 1.6 Å

PDB Description: human methionine aminopeptidase 2 complexed with tnp-470

SCOP Domain Sequences for d1b6a_2:

Sequence, based on SEQRES records: (download)

>d1b6a_2 d.127.1.1 (110-374,449-478) Methionine aminopeptidase {Human (Homo sapiens)}
kvqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndf
reaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnnca
ahytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgik
cagidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpivkg
geatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

Sequence, based on observed residues (ATOM records): (download)

>d1b6a_2 d.127.1.1 (110-374,449-478) Methionine aminopeptidase {Human (Homo sapiens)}
kvqtdppsvpicdlypngvfpkgqeceypeekkaldqaseeiwndfreaaeahrqvrkyv
mswikpgmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdttvlq
yddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdvgea
iqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpivkggeatrmeegevyai
etfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

SCOP Domain Coordinates for d1b6a_2:

Click to download the PDB-style file with coordinates for d1b6a_2.
(The format of our PDB-style files is described here.)

Timeline for d1b6a_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b6a_1