Lineage for d1b6aa2 (1b6a A:110-374,A:449-478)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538139Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2538140Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2538141Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2538190Protein Methionine aminopeptidase [55924] (6 species)
  7. 2538242Species Human (Homo sapiens) [TaxId:9606] [55927] (18 PDB entries)
    Uniprot P50579 110-478
    methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold
  8. 2538243Domain d1b6aa2: 1b6a A:110-374,A:449-478 [41160]
    Other proteins in same PDB: d1b6aa1
    complexed with co, tn4

Details for d1b6aa2

PDB Entry: 1b6a (more details), 1.6 Å

PDB Description: human methionine aminopeptidase 2 complexed with tnp-470
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d1b6aa2:

Sequence, based on SEQRES records: (download)

>d1b6aa2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]}
kvqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndf
reaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnnca
ahytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgik
cagidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpivkg
geatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

Sequence, based on observed residues (ATOM records): (download)

>d1b6aa2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]}
kvqtdppsvpicdlypngvfpkgqeceypeekkaldqaseeiwndfreaaeahrqvrkyv
mswikpgmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdttvlq
yddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdvgea
iqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpivkggeatrmeegevyai
etfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

SCOPe Domain Coordinates for d1b6aa2:

Click to download the PDB-style file with coordinates for d1b6aa2.
(The format of our PDB-style files is described here.)

Timeline for d1b6aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b6aa1