Lineage for d1xgo_2 (1xgo 1-194,272-295)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510692Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 510693Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 510694Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 510717Protein Methionine aminopeptidase [55924] (5 species)
  7. 510718Species Archaeon Pyrococcus furiosus [TaxId:2261] [55926] (4 PDB entries)
    contains insert domain with a circularly permuted "winged helix" fold
  8. 510725Domain d1xgo_2: 1xgo 1-194,272-295 [41159]
    Other proteins in same PDB: d1xgo_1

Details for d1xgo_2

PDB Entry: 1xgo (more details), 3.5 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

SCOP Domain Sequences for d1xgo_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgo_2 d.127.1.1 (1-194,272-295) Methionine aminopeptidase {Archaeon Pyrococcus furiosus}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte

SCOP Domain Coordinates for d1xgo_2:

Click to download the PDB-style file with coordinates for d1xgo_2.
(The format of our PDB-style files is described here.)

Timeline for d1xgo_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgo_1