Lineage for d1xgo_2 (1xgo 1-194,272-295)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) 
Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) Protein Methionine aminopeptidase [55924] (3 species) 
Species Pyrococcus furiosus [TaxId:186497] [55926] (4 PDB entries) 
Domain d1xgo_2: 1xgo 1-194,272-295 [41159]
Other proteins in same PDB: d1xgo_1
Details for d1xgo_2
PDB Entry: 1xgo (more details), 3.5 Å
PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus
SCOP Domain Sequences for d1xgo_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xgo_2 d.127.1.1 (1-194,272-295) Methionine aminopeptidase {Pyrococcus furiosus}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte
SCOP Domain Coordinates for d1xgo_2:
Click to download the PDB-style file with coordinates for d1xgo_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xgo_2:
- d1xgo_2 appears in SCOP 1.57
- d1xgo_2 appears in the current release, SCOPe 2.08, called d1xgoa2
View in 3D
