Lineage for d1xgmb2 (1xgm B:1-194,B:272-295)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83707Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
  4. 83708Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 83709Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 83719Protein Methionine aminopeptidase [55924] (3 species)
  7. 83720Species Archaeon Pyrococcus furiosus [TaxId:2261] [55926] (4 PDB entries)
  8. 83726Domain d1xgmb2: 1xgm B:1-194,B:272-295 [41158]
    Other proteins in same PDB: d1xgma1, d1xgmb1

Details for d1xgmb2

PDB Entry: 1xgm (more details), 2.8 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

SCOP Domain Sequences for d1xgmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgmb2 d.127.1.1 (B:1-194,B:272-295) Methionine aminopeptidase {Archaeon Pyrococcus furiosus}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte

SCOP Domain Coordinates for d1xgmb2:

Click to download the PDB-style file with coordinates for d1xgmb2.
(The format of our PDB-style files is described here.)

Timeline for d1xgmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgmb1