Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) |
Protein Methionine aminopeptidase [55924] (5 species) |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [55926] (4 PDB entries) contains insert domain with a circularly permuted "winged helix" fold |
Domain d1xgma2: 1xgm A:1-194,A:272-295 [41157] Other proteins in same PDB: d1xgma1, d1xgmb1 |
PDB Entry: 1xgm (more details), 2.8 Å
SCOP Domain Sequences for d1xgma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xgma2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Archaeon Pyrococcus furiosus [TaxId: 2261]} mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke gdvfaiepfatigaXrngivaqfehtiivekdsvivtte
Timeline for d1xgma2: