SCOP 1.75: Domain d1xgma2: 1xgm A:1-194,A:272-295

Lineage for d1xgma2 (1xgm A:1-194,A:272-295)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Methionine aminopeptidase [55924] (5 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [55926] (4 PDB entries)
   contains insert domain with a circularly permuted "winged helix" fold

8. Domain d1xgma2: 1xgm A:1-194,A:272-295 [41157]
   Other proteins in same PDB: d1xgma1, d1xgmb1

Details for d1xgma2

PDB Entry: 1xgm, 2.8 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

PDB Compounds: (A:) Methionine aminopeptidase

SCOP Domain Sequences for d1xgma2:

Sequence; same for both SEQRES and ATOM records:

>d1xgma2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte

Timeline for d1xgma2:

• d1xgma2 first appeared (with stable ids) in SCOP 1.55
  
• d1xgma2 appears in SCOP 1.73
  
• d1xgma2 appears in SCOPe 2.01
  
• d1xgma2 appears in the current release, SCOPe 2.08