Lineage for d6o3bb_ (6o3b B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742840Domain d6o3bb_: 6o3b B: [411563]
    Other proteins in same PDB: d6o3ba1, d6o3ba2, d6o3bc1, d6o3bc2, d6o3be1, d6o3be2, d6o3bh1, d6o3bh2
    automated match to d6shgh_
    complexed with gol, nag

Details for d6o3bb_

PDB Entry: 6o3b (more details), 2.5 Å

PDB Description: crystal structure of frizzled 7 crd in complex with f6 fab
PDB Compounds: (B:) Antibody Fab F6, Heavy chain

SCOPe Domain Sequences for d6o3bb_:

Sequence, based on SEQRES records: (download)

>d6o3bb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfniyyysmhwvrqapgkglewvasiyssysytsy
adsvkgrftisadtskntaylqmnslraedtavyycarsspgadygldywgqgtlvtvss
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d6o3bb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfniyyysmhwvrqapgkglewvasiyssysytsy
adsvkgrftisadtskntaylqmnslraedtavyycarsspgadygldywgqgtlvtvss
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d6o3bb_:

Click to download the PDB-style file with coordinates for d6o3bb_.
(The format of our PDB-style files is described here.)

Timeline for d6o3bb_:

  • d6o3bb_ is new in SCOPe 2.08-stable