Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d6o1fh_: 6o1f H: [411560] Other proteins in same PDB: d6o1fa_, d6o1fi_, d6o1fl1, d6o1fl2 automated match to d6shgh_ complexed with edo |
PDB Entry: 6o1f (more details), 2.15 Å
SCOPe Domain Sequences for d6o1fh_:
Sequence, based on SEQRES records: (download)
>d6o1fh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlscaasgftfsdygmvwvrqapgkglewvafissgsstvyy adtmkgrftisrdnskntlylqmnslraedtavyyctrrnyddwyfdvwgqgtlvtvssa stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
>d6o1fh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlscaasgftfsdygmvwvrqapgkglewvafissgsstvyy adtmkgrftisrdnskntlylqmnslraedtavyyctrrnyddwyfdvwgqgtlvtvssa stkgpsvfplapsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls svvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d6o1fh_:
View in 3D Domains from other chains: (mouse over for more information) d6o1fa_, d6o1fi_, d6o1fl1, d6o1fl2 |