Lineage for d1xgnb2 (1xgn B:1-194,B:272-295)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418013Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 418014Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 418015Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 418038Protein Methionine aminopeptidase [55924] (5 species)
  7. 418039Species Archaeon Pyrococcus furiosus [TaxId:2261] [55926] (4 PDB entries)
    contains insert domain with a circularly permuted "winged helix" fold
  8. 418043Domain d1xgnb2: 1xgn B:1-194,B:272-295 [41156]
    Other proteins in same PDB: d1xgna1, d1xgnb1
    complexed with co

Details for d1xgnb2

PDB Entry: 1xgn (more details), 2.9 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

SCOP Domain Sequences for d1xgnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgnb2 d.127.1.1 (B:1-194,B:272-295) Methionine aminopeptidase {Archaeon Pyrococcus furiosus}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte

SCOP Domain Coordinates for d1xgnb2:

Click to download the PDB-style file with coordinates for d1xgnb2.
(The format of our PDB-style files is described here.)

Timeline for d1xgnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgnb1