SCOP 1.55: Domain d1xgna2: 1xgn A:1-194,A:272-295

Lineage for d1xgna2 (1xgn A:1-194,A:272-295)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Methionine aminopeptidase [55924] (3 species)

7. Species Pyrococcus furiosus [TaxId:186497] [55926] (4 PDB entries)

8. Domain d1xgna2: 1xgn A:1-194,A:272-295 [41155]
   Other proteins in same PDB: d1xgna1, d1xgnb1

Details for d1xgna2

PDB Entry: 1xgn, 2.9 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

SCOP Domain Sequences for d1xgna2:

Sequence; same for both SEQRES and ATOM records:

>d1xgna2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Pyrococcus furiosus}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte

Timeline for d1xgna2:

• d1xgna2 appears in SCOP 1.57
  
• d1xgna2 appears in the current release, SCOPe 2.08