Lineage for d1xgna2 (1xgn A:1-194,A:272-295)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35625Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
  4. 35626Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 35627Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 35637Protein Methionine aminopeptidase [55924] (3 species)
  7. 35653Species Pyrococcus furiosus [TaxId:186497] [55926] (4 PDB entries)
  8. 35656Domain d1xgna2: 1xgn A:1-194,A:272-295 [41155]
    Other proteins in same PDB: d1xgna1, d1xgnb1

Details for d1xgna2

PDB Entry: 1xgn (more details), 2.9 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

SCOP Domain Sequences for d1xgna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgna2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Pyrococcus furiosus}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte

SCOP Domain Coordinates for d1xgna2:

Click to download the PDB-style file with coordinates for d1xgna2.
(The format of our PDB-style files is described here.)

Timeline for d1xgna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgna1