Lineage for d1xgsa2 (1xgs A:1-194,A:272-295)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35625Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
  4. 35626Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 35627Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 35637Protein Methionine aminopeptidase [55924] (3 species)
  7. 35653Species Pyrococcus furiosus [TaxId:186497] [55926] (4 PDB entries)
  8. 35654Domain d1xgsa2: 1xgs A:1-194,A:272-295 [41153]
    Other proteins in same PDB: d1xgsa1, d1xgsb1

Details for d1xgsa2

PDB Entry: 1xgs (more details), 1.75 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

SCOP Domain Sequences for d1xgsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgsa2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Pyrococcus furiosus}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte

SCOP Domain Coordinates for d1xgsa2:

Click to download the PDB-style file with coordinates for d1xgsa2.
(The format of our PDB-style files is described here.)

Timeline for d1xgsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgsa1