Lineage for d1xgsa2 (1xgs A:1-194,A:272-295)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974613Protein Methionine aminopeptidase [55924] (7 species)
  7. 2974684Species Pyrococcus furiosus [TaxId:2261] [55926] (5 PDB entries)
    contains insert domain with a circularly permuted "winged helix" fold
  8. 2974685Domain d1xgsa2: 1xgs A:1-194,A:272-295 [41153]
    Other proteins in same PDB: d1xgsa1, d1xgsb1
    complexed with co

Details for d1xgsa2

PDB Entry: 1xgs (more details), 1.75 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d1xgsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xgsa2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Pyrococcus furiosus [TaxId: 2261]}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte

SCOPe Domain Coordinates for d1xgsa2:

Click to download the PDB-style file with coordinates for d1xgsa2.
(The format of our PDB-style files is described here.)

Timeline for d1xgsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xgsa1