Lineage for d1mat__ (1mat -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610497Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 610498Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 610499Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 610522Protein Methionine aminopeptidase [55924] (5 species)
  7. 610531Species Escherichia coli [TaxId:562] [55925] (10 PDB entries)
  8. 610541Domain d1mat__: 1mat - [41152]
    complexed with co

Details for d1mat__

PDB Entry: 1mat (more details), 2.4 Å

PDB Description: structure of the cobalt-dependent methionine aminopeptidase from escherichia coli: a new type of proteolytic enzyme

SCOP Domain Sequences for d1mat__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mat__ d.127.1.1 (-) Methionine aminopeptidase {Escherichia coli}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde

SCOP Domain Coordinates for d1mat__:

Click to download the PDB-style file with coordinates for d1mat__.
(The format of our PDB-style files is described here.)

Timeline for d1mat__: