Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.72: Antiporter-like subunits from respiratory complex I [418732] (1 superfamily) core: 14 transmembrane helices; each has two groups of five helices are related to each other by pseudo two-fold symmetry, with the groups inverted with respect to the membrane |
Superfamily f.72.1: Antiporter-like subunits from respiratory complex I [418776] (3 families) |
Family f.72.1.0: automated matches [418886] (1 protein) not a true family |
Protein automated matches [419266] (2 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [420025] (4 PDB entries) |
Domain d6nbyd_: 6nby D: [411516] Other proteins in same PDB: d6nbyh_ automated match to d3rkom_ complexed with sf4 |
PDB Entry: 6nby (more details), 3.1 Å
SCOPe Domain Sequences for d6nbyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nbyd_ f.72.1.0 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} stfpwlttiilfpivaalaipfipdptgkgrpirwyalavglidfalivyaftnfydlnt pgmqlwesydwipeiglrwsvgadglsmplilltgfittlailaawpvtlkprlfyflml amyggqiavfavqdmlvfflawelelipvylllaiwgghkrqyaatkfilytagsslfil vaglamafygdtvsfdmqtlaakdyalgfqllvyagflvaygvklpivplhtwlpdahge atapvhmllagillkmggyalirmnvdmlpaahakfapvlvilgvvniiyaaltsyaqrn lkrkiayssishigfvligiasftnlgmsgavlqmvshgligaslfflvgatydrthtli leemggvgqkmkkifamftacslaslalpgmsgfvaelmvfigfatsdayslpfrvivvf laavgviltpiyllsmlreifygpenkelvehealvdaeprevfiiacllvpiigiglyp klltqiydattgqviararevlpt
Timeline for d6nbyd_: