Lineage for d6nbyd_ (6nby D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029539Fold f.72: Antiporter-like subunits from respiratory complex I [418732] (1 superfamily)
    core: 14 transmembrane helices; each has two groups of five helices are related to each other by pseudo two-fold symmetry, with the groups inverted with respect to the membrane
  4. 3029540Superfamily f.72.1: Antiporter-like subunits from respiratory complex I [418776] (3 families) (S)
  5. 3029567Family f.72.1.0: automated matches [418886] (1 protein)
    not a true family
  6. 3029568Protein automated matches [419266] (2 species)
    not a true protein
  7. 3029569Species Thermosynechococcus elongatus [TaxId:197221] [420025] (4 PDB entries)
  8. 3029572Domain d6nbyd_: 6nby D: [411516]
    Other proteins in same PDB: d6nbyh_
    automated match to d3rkom_
    complexed with sf4

Details for d6nbyd_

PDB Entry: 6nby (more details), 3.1 Å

PDB Description: t.elongatus ndh (composite model)
PDB Compounds: (D:) NAD(P)H-quinone oxidoreductase chain 4 1

SCOPe Domain Sequences for d6nbyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nbyd_ f.72.1.0 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
stfpwlttiilfpivaalaipfipdptgkgrpirwyalavglidfalivyaftnfydlnt
pgmqlwesydwipeiglrwsvgadglsmplilltgfittlailaawpvtlkprlfyflml
amyggqiavfavqdmlvfflawelelipvylllaiwgghkrqyaatkfilytagsslfil
vaglamafygdtvsfdmqtlaakdyalgfqllvyagflvaygvklpivplhtwlpdahge
atapvhmllagillkmggyalirmnvdmlpaahakfapvlvilgvvniiyaaltsyaqrn
lkrkiayssishigfvligiasftnlgmsgavlqmvshgligaslfflvgatydrthtli
leemggvgqkmkkifamftacslaslalpgmsgfvaelmvfigfatsdayslpfrvivvf
laavgviltpiyllsmlreifygpenkelvehealvdaeprevfiiacllvpiigiglyp
klltqiydattgqviararevlpt

SCOPe Domain Coordinates for d6nbyd_:

Click to download the PDB-style file with coordinates for d6nbyd_.
(The format of our PDB-style files is described here.)

Timeline for d6nbyd_:

  • d6nbyd_ is new in SCOPe 2.08-stable