SCOP 1.73: Domain d1c27a_: 1c27 A:

Lineage for d1c27a_ (1c27 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Methionine aminopeptidase [55924] (5 species)

7. Species Escherichia coli [TaxId:562] [55925] (29 PDB entries)

8. Domain d1c27a_: 1c27 A: [41151]

Details for d1c27a_

PDB Entry: 1c27, 1.95 Å

PDB Description: e. coli methionine aminopeptidase:norleucine phosphonate complex

PDB Compounds: (A:) Methionine aminopeptidase

SCOP Domain Sequences for d1c27a_:

Sequence; same for both SEQRES and ATOM records:

>d1c27a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishd

Timeline for d1c27a_:

• d1c27a_ first appeared (with stable ids) in SCOP 1.55
  
• d1c27a_ appears in SCOP 1.71
  
• d1c27a_ appears in SCOP 1.75
  
• d1c27a_ appears in the current release, SCOPe 2.08