Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Norovirus hu/gii.4/farmington hills/2004/usa [TaxId:1182143] [419915] (6 PDB entries) |
Domain d6n8da_: 6n8d A: [411504] Other proteins in same PDB: d6n8db1, d6n8db2, d6n8dd_, d6n8de1, d6n8de2, d6n8df_ automated match to d5or7a_ |
PDB Entry: 6n8d (more details), 3.1 Å
SCOPe Domain Sequences for d6n8da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n8da_ b.121.4.0 (A:) automated matches {Norovirus hu/gii.4/farmington hills/2004/usa [TaxId: 1182143]} kpftvpiltveemtnsrfpipleklftgpsgafvvqpqngrcttdgvllgttqlspvnic tfrgdvthiagthnytmnlasqnwnnydpteeipaplgtpdfvgriqgmltqttrgdgst rghkatvstgdvhftpklgsiqfntdtnndfetgqntkftpvgvvqdgngahqnepqqwv lpsysgrtghnvhlapavaptfpgeqllffrstmpgcsgypnmnldcllpqewvqhfyqe aapaqsdvallrfvnpdtgrvlfecklhksgyvtvahtgqhdlvippngyfrfdswvnqf ytlapm
Timeline for d6n8da_: