Lineage for d6n8da_ (6n8d A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822534Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2822535Protein automated matches [190988] (51 species)
    not a true protein
  7. 2822875Species Norovirus hu/gii.4/farmington hills/2004/usa [TaxId:1182143] [419915] (6 PDB entries)
  8. 2822888Domain d6n8da_: 6n8d A: [411504]
    Other proteins in same PDB: d6n8db1, d6n8db2, d6n8dd_, d6n8de1, d6n8de2, d6n8df_
    automated match to d5or7a_

Details for d6n8da_

PDB Entry: 6n8d (more details), 3.1 Å

PDB Description: crystal structure of gii.4 2002 norovirus p domain in complex with neutralizing human antibody a1431
PDB Compounds: (A:) Major capsid protein

SCOPe Domain Sequences for d6n8da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n8da_ b.121.4.0 (A:) automated matches {Norovirus hu/gii.4/farmington hills/2004/usa [TaxId: 1182143]}
kpftvpiltveemtnsrfpipleklftgpsgafvvqpqngrcttdgvllgttqlspvnic
tfrgdvthiagthnytmnlasqnwnnydpteeipaplgtpdfvgriqgmltqttrgdgst
rghkatvstgdvhftpklgsiqfntdtnndfetgqntkftpvgvvqdgngahqnepqqwv
lpsysgrtghnvhlapavaptfpgeqllffrstmpgcsgypnmnldcllpqewvqhfyqe
aapaqsdvallrfvnpdtgrvlfecklhksgyvtvahtgqhdlvippngyfrfdswvnqf
ytlapm

SCOPe Domain Coordinates for d6n8da_:

Click to download the PDB-style file with coordinates for d6n8da_.
(The format of our PDB-style files is described here.)

Timeline for d6n8da_:

  • d6n8da_ is new in SCOPe 2.08-stable