SCOPe 2.07: Domain d4mata1: 4mat A:2-264

Lineage for d4mata1 (4mat A:2-264)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein Methionine aminopeptidase [55924] (6 species)

7. Species Escherichia coli [TaxId:562] [55925] (32 PDB entries)
   Uniprot P07906

8. Domain d4mata1: 4mat A:2-264 [41150]
   Other proteins in same PDB: d4mata2
   complexed with na; mutant

Details for d4mata1

PDB Entry: 4mat, 2 Å

PDB Description: e.coli methionine aminopeptidase his79ala mutant

PDB Compounds: (A:) protein (methionine aminopeptidase)

SCOPe Domain Sequences for d4mata1:

Sequence; same for both SEQRES and ATOM records:

>d4mata1 d.127.1.1 (A:2-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde

Timeline for d4mata1:

• d4mata1 first appeared (with stable ids) in SCOP 1.55, called d4mata_
  
• d4mata1 appears in SCOPe 2.06
  
• d4mata1 appears in the current release, SCOPe 2.08