Lineage for d6n5ee_ (6n5e E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745214Domain d6n5ee_: 6n5e E: [411495]
    Other proteins in same PDB: d6n5ea_, d6n5eb_, d6n5ec_, d6n5ed1, d6n5ed2, d6n5ef1, d6n5ef2, d6n5ei1, d6n5ei2
    automated match to d6shgh_

Details for d6n5ee_

PDB Entry: 6n5e (more details), 3 Å

PDB Description: broadly protective antibodies directed to a subdominant influenza hemagglutinin epitope
PDB Compounds: (E:) FL-1066 heavy chain

SCOPe Domain Sequences for d6n5ee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n5ee_ b.1.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvklvesgeglvkpggslklscaasgftfsgydmswvrqtpekrlewvayissggdyiyy
adtvkgrftisrdnarntlylqmsslksedtamyyctrdsdyygsrvwfaywgqgtlvtv
sgastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscd

SCOPe Domain Coordinates for d6n5ee_:

Click to download the PDB-style file with coordinates for d6n5ee_.
(The format of our PDB-style files is described here.)

Timeline for d6n5ee_:

  • d6n5ee_ is new in SCOPe 2.08-stable