Lineage for d1c23a_ (1c23 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. Protein Methionine aminopeptidase [55924] (7 species)
  7. Species Escherichia coli [TaxId:562] [55925] (32 PDB entries)
    Uniprot P07906
  8. Domain d1c23a_: 1c23 A: [41147]
    complexed with co, mph, na

Details for d1c23a_

PDB Entry: 1c23 (more details), 2 Å

PDB Description: e. coli methionine aminopeptidase: methionine phosphonate complex
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d1c23a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c23a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishd

SCOPe Domain Coordinates for d1c23a_ are not available.

Timeline for d1c23a_: