![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) |
![]() | Protein Creatinase, catalytic (C-terminal) domain [55922] (2 species) |
![]() | Species Pseudomonas putida [TaxId:303] [55923] (1 PDB entry) |
![]() | Domain d1chmb2: 1chm B:157-402 [41143] Other proteins in same PDB: d1chma1, d1chmb1 complexed with cms |
PDB Entry: 1chm (more details), 1.9 Å
SCOP Domain Sequences for d1chmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1chmb2 d.127.1.1 (B:157-402) Creatinase, catalytic (C-terminal) domain {Pseudomonas putida} miksaeehvmirhgariadiggaavvealgdqvpeyevalhatqamvraiadtfedvelm dtwtwfqsgintdgahnpvttrkvnkgdilslncfpmiagyytalertlfldhcsddhlr lwqvnvevheaglklikpgarcsdiarelneiflkhdvlqyrtfgyghsfgtlshyygre aglelredidtvlepgmvvsmepmimlpeglpgaggyrehdilivnengaenitkfpygp ekniir
Timeline for d1chmb2: