Lineage for d1chma2 (1chm A:157-402)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418013Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 418014Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 418015Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 418031Protein Creatinase, catalytic (C-terminal) domain [55922] (2 species)
  7. 418035Species Pseudomonas putida [TaxId:303] [55923] (1 PDB entry)
  8. 418036Domain d1chma2: 1chm A:157-402 [41142]
    Other proteins in same PDB: d1chma1, d1chmb1

Details for d1chma2

PDB Entry: 1chm (more details), 1.9 Å

PDB Description: enzymatic mechanism of creatine amidinohydrolase as deduced from crystal structures

SCOP Domain Sequences for d1chma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chma2 d.127.1.1 (A:157-402) Creatinase, catalytic (C-terminal) domain {Pseudomonas putida}
miksaeehvmirhgariadiggaavvealgdqvpeyevalhatqamvraiadtfedvelm
dtwtwfqsgintdgahnpvttrkvnkgdilslncfpmiagyytalertlfldhcsddhlr
lwqvnvevheaglklikpgarcsdiarelneiflkhdvlqyrtfgyghsfgtlshyygre
aglelredidtvlepgmvvsmepmimlpeglpgaggyrehdilivnengaenitkfpygp
ekniir

SCOP Domain Coordinates for d1chma2:

Click to download the PDB-style file with coordinates for d1chma2.
(The format of our PDB-style files is described here.)

Timeline for d1chma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1chma1