Lineage for d3jdw__ (3jdw -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35598Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
  4. 35599Superfamily d.126.1: Pentein [55909] (2 families) (S)
  5. 35607Family d.126.1.2: Amidinotransferase [55914] (2 proteins)
  6. 35608Protein L-arginine: glycine amidinotransferase [55915] (1 species)
  7. 35609Species Human (Homo sapiens) [TaxId:9606] [55916] (11 PDB entries)
  8. 35615Domain d3jdw__: 3jdw - [41136]

Details for d3jdw__

PDB Entry: 3jdw (more details), 2.4 Å

PDB Description: crystal structure and mechanism of l-arginine: glycine amidinotransferase: a mitochondrial enzyme involved in creatine biosynthesis

SCOP Domain Sequences for d3jdw__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jdw__ d.126.1.2 (-) L-arginine: glycine amidinotransferase {Human (Homo sapiens)}
cpvssynewdpleevivgraenacvppftievkantyekywpfyqkqgghyfpkdhlkka
vaeieemcnilktegvtvrrpdpidwslkyktpdfestglysamprdilivvgneiieap
mawrsrffeyrayrsiikdyfhrgakwttapkptmadelynqdypihsvedrhklaaqgk
fvttefepcfdaadfiragrdifaqrsqvtnylgiewmrrhlapdyrvhiisfkdpnpmh
idatfniigpgivlsnpdrpchqidlfkkagwtiitpptpiipddhplwmsskwlsmnvl
mldekrvmvdanevpiqkmfeklgittikvnirnanslgggfhcwtcdvrrrgtlqsyld

SCOP Domain Coordinates for d3jdw__:

Click to download the PDB-style file with coordinates for d3jdw__.
(The format of our PDB-style files is described here.)

Timeline for d3jdw__: