Lineage for d6jdwa_ (6jdw A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668076Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1668077Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1668085Family d.126.1.2: Amidinotransferase [55914] (2 proteins)
    common fold is elaborated with many active site-forming insertions
  6. 1668086Protein L-arginine: glycine amidinotransferase [55915] (1 species)
  7. 1668087Species Human (Homo sapiens) [TaxId:9606] [55916] (11 PDB entries)
  8. 1668093Domain d6jdwa_: 6jdw A: [41135]
    complexed with abu

Details for d6jdwa_

PDB Entry: 6jdw (more details), 2.5 Å

PDB Description: crystal structure of human l-arginine:glycine amidinotransferase in complex with gamma-amino butyric acid
PDB Compounds: (A:) protein (l-arginine:glycine amidinotransferase)

SCOPe Domain Sequences for d6jdwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jdwa_ d.126.1.2 (A:) L-arginine: glycine amidinotransferase {Human (Homo sapiens) [TaxId: 9606]}
cpvssynewdpleevivgraenacvppftievkantyekywpfyqkqgghyfpkdhlkka
vaeieemcnilktegvtvrrpdpidwslkyktpdfestglysamprdilivvgneiieap
mawrsrffeyrayrsiikdyfhrgakwttapkptmadelynqdypihsvedrhklaaqgk
fvttefepcfdaadfiragrdifaqrsqvtnylgiewmrrhlapdyrvhiisfkdpnpmh
idatfniigpgivlsnpdrpchqidlfkkagwtiitpptpiipddhplwmsskwlsmnvl
mldekrvmvdanevpiqkmfeklgittikvnirnanslgggfhcwtcdvrrrgtlqsyld

SCOPe Domain Coordinates for d6jdwa_:

Click to download the PDB-style file with coordinates for d6jdwa_.
(The format of our PDB-style files is described here.)

Timeline for d6jdwa_: