Lineage for d6jp7h1 (6jp7 H:6-230)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755655Domain d6jp7h1: 6jp7 H:6-230 [411347]
    Other proteins in same PDB: d6jp7h2, d6jp7h3, d6jp7l2
    automated match to d6shgh_
    complexed with 3fx, p6g

Details for d6jp7h1

PDB Entry: 6jp7 (more details), 1.91 Å

PDB Description: human antibody 32d6 fab in complex with peg
PDB Compounds: (H:) Immunoglobulin Fab heavy chain

SCOPe Domain Sequences for d6jp7h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jp7h1 b.1.1.0 (H:6-230) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltctvsggsvntgsyywswirqppgkglewiayssvsgtsnynpsl
ksrvtltvdtsknqfslsvrsvtaadtavyfcarlnydiltgyyffdfwgqgtlvivssa
stkgpsvfplapssksasggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssssgtqtyicnvnhkpsntkvdkrvepkscdkt

SCOPe Domain Coordinates for d6jp7h1:

Click to download the PDB-style file with coordinates for d6jp7h1.
(The format of our PDB-style files is described here.)

Timeline for d6jp7h1:

  • d6jp7h1 is new in SCOPe 2.08-stable