Lineage for d6ionh_ (6ion H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760609Domain d6ionh_: 6ion H: [411323]
    Other proteins in same PDB: d6ionl2
    automated match to d6shgh_
    complexed with nag

Details for d6ionh_

PDB Entry: 6ion (more details), 2.75 Å

PDB Description: the complex of c4.4a with its antibody 11h10 fab fragment
PDB Compounds: (H:) anti-C4.4A antibody 11H10, heavy chain

SCOPe Domain Sequences for d6ionh_:

Sequence, based on SEQRES records: (download)

>d6ionh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vtlkesgpgilqpsqtlsltcsfsgfslnsfgtgvgwirqpsgkglewlahiwwndykyy
naalesrltiskdtsnnqvflkiasvdtadtatyycarlrlryfdywgqgttltvssakt
tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
lsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Sequence, based on observed residues (ATOM records): (download)

>d6ionh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vtlkesgpgilqpsqtlsltcsfsgfslnsfgtgvgwirqpsgkglewlahiwwndykyy
naalesrltiskdtsnnqvflkiasvdtadtatyycarlrlryfdywgqgttltvssakt
tppsvyplapmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvp
sstwpsetvtcnvahpasstkvdkkivp

SCOPe Domain Coordinates for d6ionh_:

Click to download the PDB-style file with coordinates for d6ionh_.
(The format of our PDB-style files is described here.)

Timeline for d6ionh_:

  • d6ionh_ is new in SCOPe 2.08-stable