Lineage for d6iebh1 (6ieb H:6-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757850Domain d6iebh1: 6ieb H:6-218 [411317]
    Other proteins in same PDB: d6iebe2, d6iebf2, d6iebh2, d6iebl2
    automated match to d6shgh_

Details for d6iebh1

PDB Entry: 6ieb (more details), 2.41 Å

PDB Description: structure of rvfv gn and human monoclonal antibody r15
PDB Compounds: (H:) R15 H chain

SCOPe Domain Sequences for d6iebh1:

Sequence, based on SEQRES records: (download)

>d6iebh1 b.1.1.0 (H:6-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltctvsggsistyywswirqppgkglewigyiyysgstnynpslkt
rvtisvdtsknqfslklssvtaadtavyycarsdygdlifdywgqgtlvtvssastkgps
vfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d6iebh1 b.1.1.0 (H:6-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltctvsggsistyywswirqppgkglewigyiyysgstnynpslkt
rvtisvdtsknqfslklssvtaadtavyycarsdygdlifdywgqgtlvtvssastkgps
vfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpss
slgtqtyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d6iebh1:

Click to download the PDB-style file with coordinates for d6iebh1.
(The format of our PDB-style files is described here.)

Timeline for d6iebh1:

  • d6iebh1 is new in SCOPe 2.08-stable