SCOPe 2.08: Domain d6iebe1: 6ieb E:6-213

Lineage for d6iebe1 (6ieb E:6-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6iebe1: 6ieb E:6-213 [411315]
   Other proteins in same PDB: d6iebe2, d6iebf2, d6iebh2, d6iebl2
   automated match to d6shgh_

Details for d6iebe1

PDB Entry: 6ieb, 2.41 Å

PDB Description: structure of rvfv gn and human monoclonal antibody r15

PDB Compounds: (E:) R15 H chain

SCOPe Domain Sequences for d6iebe1:

Sequence, based on SEQRES records:

>d6iebe1 b.1.1.0 (E:6-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltctvsggsistyywswirqppgkglewigyiyysgstnynpslkt
rvtisvdtsknqfslklssvtaadtavyycarsdygdlifdywgqgtlvtvssastkgps
vfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvd

Sequence, based on observed residues (ATOM records):

>d6iebe1 b.1.1.0 (E:6-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltctvsggsistyywswirqppgkglewigyiyysgstnynpslkt
rvtisvdtsknqfslklssvtaadtavyycarsdygdlifdywgqgtlvtvssastkgps
vfplgclvkdyfpepvtvswnsgavhtfpavlqssglyslssvvcnvnhkpsntkvd

Timeline for d6iebe1:

• d6iebe1 is new in SCOPe 2.08-stable